Elevated expression of alpha-B crystallin occurs in many neurological diseases a missense mutation cosegregated in a family with a desmin-related myopathy. Alpha-A and alpha-B gene products are differentially expressed alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. These heterogeneous aggregates consist of 30-40 subunits the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone instead they hold them in large soluble aggregates. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Mammalian lens crystallins are divided into alpha, beta, and gamma families. The DNA is stable for at least one year from date of shipping when stored at -20☌. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.ĥ. Close the tube and incubate for 10 minutes at room temperature.Ĥ. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.ģ.
#Serial cloner clone in oligo serial#
Serial Cloner handles Annotations and Features both in the sequence and in the Graphic Map. Powerful graphical display tools and simple interfaces help the analysis and construction steps in a very intuitive way. Import from MacVector is also possible now. The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).Ģ. Serial Cloner also import files saved in the Vector NTI, ApE, pDRAW32 and GenBank formats. Expression varies depending on the nature of the gene. This clone was engineered to express the complete ORF with an expression tag. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. polymorphisms), each with its own valid existence. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. SgfI-MluI Cloning Scheme for this gene Plasmid Map
#Serial cloner clone in oligo download#
Sequencher program is needed, download here. MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLĮKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSD
0 kommentar(er)
